Description
Product Description
Protein Description: mitogen-activated protein kinase 8 interacting protein 1
Gene Name: MAPK8IP1
Alternative Gene Name: IB1, JIP-1, JIP1, PRKM8IP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027223: 98%, ENSRNOG00000058478: 98%
Entrez Gene ID: 9479
Uniprot ID: Q9UQF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAPK8IP1
Alternative Gene Name: IB1, JIP-1, JIP1, PRKM8IP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027223: 98%, ENSRNOG00000058478: 98%
Entrez Gene ID: 9479
Uniprot ID: Q9UQF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GVFPAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLC |
Gene Sequence | GVFPAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLC |
Gene ID - Mouse | ENSMUSG00000027223 |
Gene ID - Rat | ENSRNOG00000058478 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MAPK8IP1 pAb (ATL-HPA058921) | |
Datasheet | Anti MAPK8IP1 pAb (ATL-HPA058921) Datasheet (External Link) |
Vendor Page | Anti MAPK8IP1 pAb (ATL-HPA058921) at Atlas Antibodies |
Documents & Links for Anti MAPK8IP1 pAb (ATL-HPA058921) | |
Datasheet | Anti MAPK8IP1 pAb (ATL-HPA058921) Datasheet (External Link) |
Vendor Page | Anti MAPK8IP1 pAb (ATL-HPA058921) |