Description
Product Description
Protein Description: mitogen-activated protein kinase kinase kinase kinase 5
Gene Name: MAP4K5
Alternative Gene Name: GCKR, KHS, KHS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034761: 98%, ENSRNOG00000004923: 96%
Entrez Gene ID: 11183
Uniprot ID: Q9Y4K4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAP4K5
Alternative Gene Name: GCKR, KHS, KHS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034761: 98%, ENSRNOG00000004923: 96%
Entrez Gene ID: 11183
Uniprot ID: Q9Y4K4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WLYVINNTLMSLSEGKTFQLYSHNLIALFEHAKKPGLAAHIQTHRFPDRI |
Gene Sequence | WLYVINNTLMSLSEGKTFQLYSHNLIALFEHAKKPGLAAHIQTHRFPDRI |
Gene ID - Mouse | ENSMUSG00000034761 |
Gene ID - Rat | ENSRNOG00000004923 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MAP4K5 pAb (ATL-HPA078030) | |
Datasheet | Anti MAP4K5 pAb (ATL-HPA078030) Datasheet (External Link) |
Vendor Page | Anti MAP4K5 pAb (ATL-HPA078030) at Atlas Antibodies |
Documents & Links for Anti MAP4K5 pAb (ATL-HPA078030) | |
Datasheet | Anti MAP4K5 pAb (ATL-HPA078030) Datasheet (External Link) |
Vendor Page | Anti MAP4K5 pAb (ATL-HPA078030) |