Protein Description: mitogen-activated protein kinase kinase kinase 7
Gene Name: MAP3K7
Alternative Gene Name: MEKK7, TAK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028284: 97%, ENSRNOG00000047516: 97%
Entrez Gene ID: 6885
Uniprot ID: O43318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAP3K7
Alternative Gene Name: MEKK7, TAK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028284: 97%, ENSRNOG00000047516: 97%
Entrez Gene ID: 6885
Uniprot ID: O43318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGNILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQ |
| Documents & Links for Anti MAP3K7 pAb (ATL-HPA075335) | |
| Datasheet | Anti MAP3K7 pAb (ATL-HPA075335) Datasheet (External Link) |
| Vendor Page | Anti MAP3K7 pAb (ATL-HPA075335) at Atlas |
| Documents & Links for Anti MAP3K7 pAb (ATL-HPA075335) | |
| Datasheet | Anti MAP3K7 pAb (ATL-HPA075335) Datasheet (External Link) |
| Vendor Page | Anti MAP3K7 pAb (ATL-HPA075335) |