Anti MAP3K7 pAb (ATL-HPA075335)

Atlas Antibodies

Catalog No: ATL-HPA075335-25

• 

Product Description

Protein Description: mitogen-activated protein kinase kinase kinase 7
Gene Name: MAP3K7
Alternative Gene Name: MEKK7, TAK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028284: 97%, ENSRNOG00000047516: 97%
Entrez Gene ID: 6885
Uniprot ID: O43318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGNILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQ
• Gene Sequence: PTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGNILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQ
• Gene ID - Mouse: ENSMUSG00000028284
• Gene ID - Rat: ENSRNOG00000047516
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.