Protein Description: mitogen-activated protein kinase kinase kinase 5
Gene Name: MAP3K5
Alternative Gene Name: ASK1, MAPKKK5, MEKK5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071369: 86%, ENSRNOG00000031700: 84%
Entrez Gene ID: 4217
Uniprot ID: Q99683
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAP3K5
Alternative Gene Name: ASK1, MAPKKK5, MEKK5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071369: 86%, ENSRNOG00000031700: 84%
Entrez Gene ID: 4217
Uniprot ID: Q99683
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT |
| Documents & Links for Anti MAP3K5 pAb (ATL-HPA064423) | |
| Datasheet | Anti MAP3K5 pAb (ATL-HPA064423) Datasheet (External Link) |
| Vendor Page | Anti MAP3K5 pAb (ATL-HPA064423) at Atlas |
| Documents & Links for Anti MAP3K5 pAb (ATL-HPA064423) | |
| Datasheet | Anti MAP3K5 pAb (ATL-HPA064423) Datasheet (External Link) |
| Vendor Page | Anti MAP3K5 pAb (ATL-HPA064423) |