Anti MAP3K5 pAb (ATL-HPA064423)

Catalog No:
ATL-HPA064423-25
$328.00

Description

Product Description

Protein Description: mitogen-activated protein kinase kinase kinase 5
Gene Name: MAP3K5
Alternative Gene Name: ASK1, MAPKKK5, MEKK5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071369: 86%, ENSRNOG00000031700: 84%
Entrez Gene ID: 4217
Uniprot ID: Q99683
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
Gene Sequence KSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
Gene ID - Mouse ENSMUSG00000071369
Gene ID - Rat ENSRNOG00000031700
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MAP3K5 pAb (ATL-HPA064423)
Datasheet Anti MAP3K5 pAb (ATL-HPA064423) Datasheet (External Link)
Vendor Page Anti MAP3K5 pAb (ATL-HPA064423) at Atlas Antibodies

Documents & Links for Anti MAP3K5 pAb (ATL-HPA064423)
Datasheet Anti MAP3K5 pAb (ATL-HPA064423) Datasheet (External Link)
Vendor Page Anti MAP3K5 pAb (ATL-HPA064423)

Product Description

Protein Description: mitogen-activated protein kinase kinase kinase 5
Gene Name: MAP3K5
Alternative Gene Name: ASK1, MAPKKK5, MEKK5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071369: 86%, ENSRNOG00000031700: 84%
Entrez Gene ID: 4217
Uniprot ID: Q99683
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
Gene Sequence KSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
Gene ID - Mouse ENSMUSG00000071369
Gene ID - Rat ENSRNOG00000031700
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MAP3K5 pAb (ATL-HPA064423)
Datasheet Anti MAP3K5 pAb (ATL-HPA064423) Datasheet (External Link)
Vendor Page Anti MAP3K5 pAb (ATL-HPA064423) at Atlas Antibodies

Documents & Links for Anti MAP3K5 pAb (ATL-HPA064423)
Datasheet Anti MAP3K5 pAb (ATL-HPA064423) Datasheet (External Link)
Vendor Page Anti MAP3K5 pAb (ATL-HPA064423)