Protein Description: mitogen-activated protein kinase kinase 7
Gene Name: MAP2K7
Alternative Gene Name: Jnkk2, MKK7, PRKMK7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109061: 99%, ENSRNOG00000001047: 99%
Entrez Gene ID: 5609
Uniprot ID: O14733
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAP2K7
Alternative Gene Name: Jnkk2, MKK7, PRKMK7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109061: 99%, ENSRNOG00000001047: 99%
Entrez Gene ID: 5609
Uniprot ID: O14733
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVK |
Documents & Links for Anti MAP2K7 pAb (ATL-HPA064711) | |
Datasheet | Anti MAP2K7 pAb (ATL-HPA064711) Datasheet (External Link) |
Vendor Page | Anti MAP2K7 pAb (ATL-HPA064711) at Atlas |
Documents & Links for Anti MAP2K7 pAb (ATL-HPA064711) | |
Datasheet | Anti MAP2K7 pAb (ATL-HPA064711) Datasheet (External Link) |
Vendor Page | Anti MAP2K7 pAb (ATL-HPA064711) |