Anti MAP2K7 pAb (ATL-HPA064711)

Atlas Antibodies

Catalog No: ATL-HPA064711-25

• 

Product Description

Protein Description: mitogen-activated protein kinase kinase 7
Gene Name: MAP2K7
Alternative Gene Name: Jnkk2, MKK7, PRKMK7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109061: 99%, ENSRNOG00000001047: 99%
Entrez Gene ID: 5609
Uniprot ID: O14733
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVK
• Gene Sequence: RHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVK
• Gene ID - Mouse: ENSMUSG00000109061
• Gene ID - Rat: ENSRNOG00000001047
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.