Protein Description: microtubule-associated protein 1 light chain 3 gamma
Gene Name: MAP1LC3C
Alternative Gene Name: ATG8J
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031812: 50%, ENSRNOG00000038106: 50%
Entrez Gene ID: 440738
Uniprot ID: Q9BXW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAP1LC3C
Alternative Gene Name: ATG8J
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031812: 50%, ENSRNOG00000038106: 50%
Entrez Gene ID: 440738
Uniprot ID: Q9BXW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TKFLVPQELTMTQFLSIIRSRMVLRATEAF |
Documents & Links for Anti MAP1LC3C pAb (ATL-HPA072670) | |
Datasheet | Anti MAP1LC3C pAb (ATL-HPA072670) Datasheet (External Link) |
Vendor Page | Anti MAP1LC3C pAb (ATL-HPA072670) at Atlas |
Documents & Links for Anti MAP1LC3C pAb (ATL-HPA072670) | |
Datasheet | Anti MAP1LC3C pAb (ATL-HPA072670) Datasheet (External Link) |
Vendor Page | Anti MAP1LC3C pAb (ATL-HPA072670) |