Anti MAOA pAb (ATL-HPA059299 w/enhanced validation)

Catalog No:
ATL-HPA059299-100
$554.00

Description

Product Description

Protein Description: monoamine oxidase A
Gene Name: MAOA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025037: 85%, ENSRNOG00000002848: 83%
Entrez Gene ID: 4128
Uniprot ID: P21397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVS
Gene Sequence VLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVS
Gene ID - Mouse ENSMUSG00000025037
Gene ID - Rat ENSRNOG00000002848
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MAOA pAb (ATL-HPA059299 w/enhanced validation)
Datasheet Anti MAOA pAb (ATL-HPA059299 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MAOA pAb (ATL-HPA059299 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MAOA pAb (ATL-HPA059299 w/enhanced validation)
Datasheet Anti MAOA pAb (ATL-HPA059299 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MAOA pAb (ATL-HPA059299 w/enhanced validation)

Product Description

Protein Description: monoamine oxidase A
Gene Name: MAOA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025037: 85%, ENSRNOG00000002848: 83%
Entrez Gene ID: 4128
Uniprot ID: P21397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVS
Gene Sequence VLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVS
Gene ID - Mouse ENSMUSG00000025037
Gene ID - Rat ENSRNOG00000002848
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MAOA pAb (ATL-HPA059299 w/enhanced validation)
Datasheet Anti MAOA pAb (ATL-HPA059299 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MAOA pAb (ATL-HPA059299 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MAOA pAb (ATL-HPA059299 w/enhanced validation)
Datasheet Anti MAOA pAb (ATL-HPA059299 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MAOA pAb (ATL-HPA059299 w/enhanced validation)