Anti MAOA pAb (ATL-HPA059299 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA059299-100

• 
• 
• 

Product Description

Protein Description: monoamine oxidase A
Gene Name: MAOA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025037: 85%, ENSRNOG00000002848: 83%
Entrez Gene ID: 4128
Uniprot ID: P21397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVS
• Gene Sequence: VLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVS
• Gene ID - Mouse: ENSMUSG00000025037
• Gene ID - Rat: ENSRNOG00000002848
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.