Protein Description: mannosidase, alpha, class 2C, member 1
Gene Name: MAN2C1
Alternative Gene Name: MANA, MANA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032295: 84%, ENSRNOG00000030654: 88%
Entrez Gene ID: 4123
Uniprot ID: Q9NTJ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAN2C1
Alternative Gene Name: MANA, MANA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032295: 84%, ENSRNOG00000030654: 88%
Entrez Gene ID: 4123
Uniprot ID: Q9NTJ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LGKDNQRSFQALYTANQMVNVCDPAQPETFPVAQALASRFFGQHGGESQHTIHATGHCHIDTAWLWPFKETVRKCARSWVTALQLMERNP |
Documents & Links for Anti MAN2C1 pAb (ATL-HPA067407) | |
Datasheet | Anti MAN2C1 pAb (ATL-HPA067407) Datasheet (External Link) |
Vendor Page | Anti MAN2C1 pAb (ATL-HPA067407) at Atlas |
Documents & Links for Anti MAN2C1 pAb (ATL-HPA067407) | |
Datasheet | Anti MAN2C1 pAb (ATL-HPA067407) Datasheet (External Link) |
Vendor Page | Anti MAN2C1 pAb (ATL-HPA067407) |