Protein Description: matrix AAA peptidase interacting protein 1
Gene Name: MAIP1
Alternative Gene Name: C2orf47, DKFZp666A212, FLJ22555
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025971: 88%, ENSRNOG00000015983: 86%
Entrez Gene ID: 79568
Uniprot ID: Q8WWC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAIP1
Alternative Gene Name: C2orf47, DKFZp666A212, FLJ22555
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025971: 88%, ENSRNOG00000015983: 86%
Entrez Gene ID: 79568
Uniprot ID: Q8WWC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIV |
Documents & Links for Anti MAIP1 pAb (ATL-HPA072231) | |
Datasheet | Anti MAIP1 pAb (ATL-HPA072231) Datasheet (External Link) |
Vendor Page | Anti MAIP1 pAb (ATL-HPA072231) at Atlas |
Documents & Links for Anti MAIP1 pAb (ATL-HPA072231) | |
Datasheet | Anti MAIP1 pAb (ATL-HPA072231) Datasheet (External Link) |
Vendor Page | Anti MAIP1 pAb (ATL-HPA072231) |