Anti MAIP1 pAb (ATL-HPA064013)

Catalog No:
ATL-HPA064013-100
$596.00

Description

Product Description

Protein Description: matrix AAA peptidase interacting protein 1
Gene Name: MAIP1
Alternative Gene Name: C2orf47, DKFZp666A212, FLJ22555
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025971: 88%, ENSRNOG00000015983: 86%
Entrez Gene ID: 79568
Uniprot ID: Q8WWC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIV
Gene Sequence FAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIV
Gene ID - Mouse ENSMUSG00000025971
Gene ID - Rat ENSRNOG00000015983
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MAIP1 pAb (ATL-HPA064013)
Datasheet Anti MAIP1 pAb (ATL-HPA064013) Datasheet (External Link)
Vendor Page Anti MAIP1 pAb (ATL-HPA064013) at Atlas Antibodies

Documents & Links for Anti MAIP1 pAb (ATL-HPA064013)
Datasheet Anti MAIP1 pAb (ATL-HPA064013) Datasheet (External Link)
Vendor Page Anti MAIP1 pAb (ATL-HPA064013)

Product Description

Protein Description: matrix AAA peptidase interacting protein 1
Gene Name: MAIP1
Alternative Gene Name: C2orf47, DKFZp666A212, FLJ22555
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025971: 88%, ENSRNOG00000015983: 86%
Entrez Gene ID: 79568
Uniprot ID: Q8WWC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIV
Gene Sequence FAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIV
Gene ID - Mouse ENSMUSG00000025971
Gene ID - Rat ENSRNOG00000015983
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MAIP1 pAb (ATL-HPA064013)
Datasheet Anti MAIP1 pAb (ATL-HPA064013) Datasheet (External Link)
Vendor Page Anti MAIP1 pAb (ATL-HPA064013) at Atlas Antibodies

Documents & Links for Anti MAIP1 pAb (ATL-HPA064013)
Datasheet Anti MAIP1 pAb (ATL-HPA064013) Datasheet (External Link)
Vendor Page Anti MAIP1 pAb (ATL-HPA064013)