Description
Product Description
Protein Description: membrane associated guanylate kinase, WW and PDZ domain containing 1
Gene Name: MAGI1
Alternative Gene Name: AIP3, BAIAP1, BAP1, MAGI-1, TNRC19, WWP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045095: 94%, ENSRNOG00000022060: 94%
Entrez Gene ID: 9223
Uniprot ID: Q96QZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAGI1
Alternative Gene Name: AIP3, BAIAP1, BAP1, MAGI-1, TNRC19, WWP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045095: 94%, ENSRNOG00000022060: 94%
Entrez Gene ID: 9223
Uniprot ID: Q96QZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHTPSQQGTQETRNTTKPKQESQFEFKAPQATQEQDF |
Gene Sequence | ITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHTPSQQGTQETRNTTKPKQESQFEFKAPQATQEQDF |
Gene ID - Mouse | ENSMUSG00000045095 |
Gene ID - Rat | ENSRNOG00000022060 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MAGI1 pAb (ATL-HPA077002) | |
Datasheet | Anti MAGI1 pAb (ATL-HPA077002) Datasheet (External Link) |
Vendor Page | Anti MAGI1 pAb (ATL-HPA077002) at Atlas Antibodies |
Documents & Links for Anti MAGI1 pAb (ATL-HPA077002) | |
Datasheet | Anti MAGI1 pAb (ATL-HPA077002) Datasheet (External Link) |
Vendor Page | Anti MAGI1 pAb (ATL-HPA077002) |