Description
Product Description
Protein Description: melanoma antigen family C, 2
Gene Name: MAGEC2
Alternative Gene Name: CT10, MAGE-C2, MAGEE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030742: 42%, ENSRNOG00000025324: 33%
Entrez Gene ID: 51438
Uniprot ID: Q9UBF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAGEC2
Alternative Gene Name: CT10, MAGE-C2, MAGEE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030742: 42%, ENSRNOG00000025324: 33%
Entrez Gene ID: 51438
Uniprot ID: Q9UBF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPS |
Gene Sequence | PVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPS |
Gene ID - Mouse | ENSMUSG00000030742 |
Gene ID - Rat | ENSRNOG00000025324 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MAGEC2 pAb (ATL-HPA062230 w/enhanced validation) | |
Datasheet | Anti MAGEC2 pAb (ATL-HPA062230 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MAGEC2 pAb (ATL-HPA062230 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti MAGEC2 pAb (ATL-HPA062230 w/enhanced validation) | |
Datasheet | Anti MAGEC2 pAb (ATL-HPA062230 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MAGEC2 pAb (ATL-HPA062230 w/enhanced validation) |
Citations
Citations for Anti MAGEC2 pAb (ATL-HPA062230 w/enhanced validation) – 4 Found |
Djureinovic, Dijana; Hallström, Björn M; Horie, Masafumi; Mattsson, Johanna Sofia Margareta; La Fleur, Linnea; Fagerberg, Linn; Brunnström, Hans; Lindskog, Cecilia; Madjar, Katrin; Rahnenführer, Jörg; Ekman, Simon; Ståhle, Elisabeth; Koyi, Hirsh; Brandén, Eva; Edlund, Karolina; Hengstler, Jan G; Lambe, Mats; Saito, Akira; Botling, Johan; Pontén, Fredrik; Uhlén, Mathias; Micke, Patrick. Profiling cancer testis antigens in non-small-cell lung cancer. Jci Insight. 2016;1(10):e86837. PubMed |
Miyamoto, Ai; Honjo, Tomoko; Masui, Mirei; Kinoshita, Rie; Kumon, Hiromi; Kakimi, Kazuhiro; Futami, Junichiro. Engineering Cancer/Testis Antigens With Reversible S-Cationization to Evaluate Antigen Spreading. Frontiers In Oncology. 12( 35600379):869393. PubMed |
Westdorp, Harm; Creemers, Jeroen H A; van Oort, Inge M; Schreibelt, Gerty; Gorris, Mark A J; Mehra, Niven; Simons, Michiel; de Goede, Anna L; van Rossum, Michelle M; Croockewit, Alexandra J; Figdor, Carl G; Witjes, J Alfred; Aarntzen, Erik H J G; Mus, Roel D M; Brüning, Mareke; Petry, Katja; Gotthardt, Martin; Barentsz, Jelle O; de Vries, I Jolanda M; Gerritsen, Winald R. Blood-derived dendritic cell vaccinations induce immune responses that correlate with clinical outcome in patients with chemo-naive castration-resistant prostate cancer. Journal For Immunotherapy Of Cancer. 2019;7(1):302. PubMed |
Bloemendal, Martine; Bol, Kalijn F; Boudewijns, Steve; Gorris, Mark A J; de Wilt, Johannes H W; Croockewit, Sandra A J; van Rossum, Michelle M; de Goede, Anna L; Petry, Katja; Koornstra, Rutger H T; Figdor, Carl; Gerritsen, Winald R; Schreibelt, Gerty; de Vries, I Jolanda M. Immunological responses to adjuvant vaccination with combined CD1c(+) myeloid and plasmacytoid dendritic cells in stage III melanoma patients. Oncoimmunology. 11(1):2015113. PubMed |