Protein Description: MAGE family member B6
Gene Name: MAGEB6
Alternative Gene Name: CT3.4, FLJ40242, MAGE-B6, MAGEB6A
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 158809
Uniprot ID: Q8N7X4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAGEB6
Alternative Gene Name: CT3.4, FLJ40242, MAGE-B6, MAGEB6A
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 158809
Uniprot ID: Q8N7X4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SSSSSSRACLGDCRRSSDASIPQESQGVSPTGSPDAVVSYSKSDVAANGQDEKSPSTSRD |
| Documents & Links for Anti MAGEB6 pAb (ATL-HPA076711 w/enhanced validation) | |
| Datasheet | Anti MAGEB6 pAb (ATL-HPA076711 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MAGEB6 pAb (ATL-HPA076711 w/enhanced validation) at Atlas |
| Documents & Links for Anti MAGEB6 pAb (ATL-HPA076711 w/enhanced validation) | |
| Datasheet | Anti MAGEB6 pAb (ATL-HPA076711 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MAGEB6 pAb (ATL-HPA076711 w/enhanced validation) |