Protein Description: melanoma antigen family B3
Gene Name: MAGEB3
Alternative Gene Name: CT3.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020831: 31%, ENSRNOG00000002468: 30%
Entrez Gene ID: 4114
Uniprot ID: O15480
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAGEB3
Alternative Gene Name: CT3.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020831: 31%, ENSRNOG00000002468: 30%
Entrez Gene ID: 4114
Uniprot ID: O15480
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TRGQTQDHQGAQITATNKKKVSFSSPLILGATIQKKSAGRSRSALKKPQRA |
| Documents & Links for Anti MAGEB3 pAb (ATL-HPA072203) | |
| Datasheet | Anti MAGEB3 pAb (ATL-HPA072203) Datasheet (External Link) |
| Vendor Page | Anti MAGEB3 pAb (ATL-HPA072203) at Atlas |
| Documents & Links for Anti MAGEB3 pAb (ATL-HPA072203) | |
| Datasheet | Anti MAGEB3 pAb (ATL-HPA072203) Datasheet (External Link) |
| Vendor Page | Anti MAGEB3 pAb (ATL-HPA072203) |