Protein Description: melanoma antigen family B2
Gene Name: MAGEB2
Alternative Gene Name: CT3.2, DAM6, MAGE-XP-2, MGC26438
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073069: 43%, ENSRNOG00000055102: 40%
Entrez Gene ID: 4113
Uniprot ID: O15479
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAGEB2
Alternative Gene Name: CT3.2, DAM6, MAGE-XP-2, MGC26438
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073069: 43%, ENSRNOG00000055102: 40%
Entrez Gene ID: 4113
Uniprot ID: O15479
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP |
| Documents & Links for Anti MAGEB2 pAb (ATL-HPA065224) | |
| Datasheet | Anti MAGEB2 pAb (ATL-HPA065224) Datasheet (External Link) |
| Vendor Page | Anti MAGEB2 pAb (ATL-HPA065224) at Atlas |
| Documents & Links for Anti MAGEB2 pAb (ATL-HPA065224) | |
| Datasheet | Anti MAGEB2 pAb (ATL-HPA065224) Datasheet (External Link) |
| Vendor Page | Anti MAGEB2 pAb (ATL-HPA065224) |