Anti MAGEB16 pAb (ATL-HPA076456)

Catalog No:
ATL-HPA076456-25
$447.00
Protein Description: MAGE family member B16
Gene Name: MAGEB16
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046942: 48%, ENSRNOG00000054784: 48%
Entrez Gene ID: 139604
Uniprot ID: A2A368
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence SEDTSDPRNVPADALDQKVAFLVNFMLHKCQMK
Gene ID - Mouse ENSMUSG00000046942
Gene ID - Rat ENSMUSG00000046942
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti MAGEB16 pAb (ATL-HPA076456)
Datasheet Anti MAGEB16 pAb (ATL-HPA076456) Datasheet (External Link)
Vendor Page Anti MAGEB16 pAb (ATL-HPA076456) at Atlas

Documents & Links for Anti MAGEB16 pAb (ATL-HPA076456)
Datasheet Anti MAGEB16 pAb (ATL-HPA076456) Datasheet (External Link)
Vendor Page Anti MAGEB16 pAb (ATL-HPA076456)