Description
Product Description
Protein Description: MAGE family member B16
Gene Name: MAGEB16
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046942: 48%, ENSRNOG00000054784: 48%
Entrez Gene ID: 139604
Uniprot ID: A2A368
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAGEB16
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046942: 48%, ENSRNOG00000054784: 48%
Entrez Gene ID: 139604
Uniprot ID: A2A368
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SEDTSDPRNVPADALDQKVAFLVNFMLHKCQMK |
Gene Sequence | SEDTSDPRNVPADALDQKVAFLVNFMLHKCQMK |
Gene ID - Mouse | ENSMUSG00000046942 |
Gene ID - Rat | ENSRNOG00000054784 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MAGEB16 pAb (ATL-HPA076456) | |
Datasheet | Anti MAGEB16 pAb (ATL-HPA076456) Datasheet (External Link) |
Vendor Page | Anti MAGEB16 pAb (ATL-HPA076456) at Atlas Antibodies |
Documents & Links for Anti MAGEB16 pAb (ATL-HPA076456) | |
Datasheet | Anti MAGEB16 pAb (ATL-HPA076456) Datasheet (External Link) |
Vendor Page | Anti MAGEB16 pAb (ATL-HPA076456) |