Protein Description: MAGE family member B16
Gene Name: MAGEB16
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046942: 48%, ENSRNOG00000054784: 48%
Entrez Gene ID: 139604
Uniprot ID: A2A368
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAGEB16
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046942: 48%, ENSRNOG00000054784: 48%
Entrez Gene ID: 139604
Uniprot ID: A2A368
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SEDTSDPRNVPADALDQKVAFLVNFMLHKCQMK |
| Documents & Links for Anti MAGEB16 pAb (ATL-HPA076456) | |
| Datasheet | Anti MAGEB16 pAb (ATL-HPA076456) Datasheet (External Link) |
| Vendor Page | Anti MAGEB16 pAb (ATL-HPA076456) at Atlas |
| Documents & Links for Anti MAGEB16 pAb (ATL-HPA076456) | |
| Datasheet | Anti MAGEB16 pAb (ATL-HPA076456) Datasheet (External Link) |
| Vendor Page | Anti MAGEB16 pAb (ATL-HPA076456) |