Description
Product Description
Protein Description: melanoma antigen family B, 10
Gene Name: MAGEB10
Alternative Gene Name: FLJ32965
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045330: 30%, ENSRNOG00000052773: 30%
Entrez Gene ID: 139422
Uniprot ID: Q96LZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAGEB10
Alternative Gene Name: FLJ32965
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045330: 30%, ENSRNOG00000052773: 30%
Entrez Gene ID: 139422
Uniprot ID: Q96LZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LDILEEEEESPPSASACLKDVFQSSLDGASNNPHGLREAQSTSTSATAASHTRHPEGVNDQMEERPICTQDLEATDSFPRGPVDEKVIILVHYLLYKYQMKEPITKADMLR |
Gene Sequence | LDILEEEEESPPSASACLKDVFQSSLDGASNNPHGLREAQSTSTSATAASHTRHPEGVNDQMEERPICTQDLEATDSFPRGPVDEKVIILVHYLLYKYQMKEPITKADMLR |
Gene ID - Mouse | ENSMUSG00000045330 |
Gene ID - Rat | ENSRNOG00000052773 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MAGEB10 pAb (ATL-HPA000611) | |
Datasheet | Anti MAGEB10 pAb (ATL-HPA000611) Datasheet (External Link) |
Vendor Page | Anti MAGEB10 pAb (ATL-HPA000611) at Atlas Antibodies |
Documents & Links for Anti MAGEB10 pAb (ATL-HPA000611) | |
Datasheet | Anti MAGEB10 pAb (ATL-HPA000611) Datasheet (External Link) |
Vendor Page | Anti MAGEB10 pAb (ATL-HPA000611) |