Description
Product Description
Protein Description: melanoma antigen family A10
Gene Name: MAGEA10
Alternative Gene Name: CT1.10, MAGE10, MGC10599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043453: 43%, ENSRNOG00000052773: 43%
Entrez Gene ID: 4109
Uniprot ID: P43363
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAGEA10
Alternative Gene Name: CT1.10, MAGE10, MGC10599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043453: 43%, ENSRNOG00000052773: 43%
Entrez Gene ID: 4109
Uniprot ID: P43363
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTST |
| Gene Sequence | MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTST |
| Gene ID - Mouse | ENSMUSG00000043453 |
| Gene ID - Rat | ENSRNOG00000052773 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti MAGEA10 pAb (ATL-HPA070780) | |
| Datasheet | Anti MAGEA10 pAb (ATL-HPA070780) Datasheet (External Link) |
| Vendor Page | Anti MAGEA10 pAb (ATL-HPA070780) at Atlas Antibodies |
| Documents & Links for Anti MAGEA10 pAb (ATL-HPA070780) | |
| Datasheet | Anti MAGEA10 pAb (ATL-HPA070780) Datasheet (External Link) |
| Vendor Page | Anti MAGEA10 pAb (ATL-HPA070780) |