Protein Description: maelstrom spermatogenic transposon silencer
Gene Name: MAEL
Alternative Gene Name: CT128, FLJ14904, SPATA35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040629: 90%, ENSRNOG00000003790: 90%
Entrez Gene ID: 84944
Uniprot ID: Q96JY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAEL
Alternative Gene Name: CT128, FLJ14904, SPATA35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040629: 90%, ENSRNOG00000003790: 90%
Entrez Gene ID: 84944
Uniprot ID: Q96JY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PVFTPLRRPGMLVPKQNVSPPDMSALSLKGDQALLGGIFYFLNIFSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFH |
| Documents & Links for Anti MAEL pAb (ATL-HPA078602) | |
| Datasheet | Anti MAEL pAb (ATL-HPA078602) Datasheet (External Link) |
| Vendor Page | Anti MAEL pAb (ATL-HPA078602) at Atlas |
| Documents & Links for Anti MAEL pAb (ATL-HPA078602) | |
| Datasheet | Anti MAEL pAb (ATL-HPA078602) Datasheet (External Link) |
| Vendor Page | Anti MAEL pAb (ATL-HPA078602) |