Description
Product Description
Protein Description: mucosal vascular addressin cell adhesion molecule 1
Gene Name: MADCAM1
Alternative Gene Name: MACAM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006542: 31%, ENSRNOG00000030017: 33%
Entrez Gene ID: 8174
Uniprot ID: Q13477
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MADCAM1
Alternative Gene Name: MACAM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006542: 31%, ENSRNOG00000030017: 33%
Entrez Gene ID: 8174
Uniprot ID: Q13477
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YHLWKRCRHLAEDDTHPPASLRLLPQVSAWAGLRGTGQVGIS |
Gene Sequence | YHLWKRCRHLAEDDTHPPASLRLLPQVSAWAGLRGTGQVGIS |
Gene ID - Mouse | ENSMUSG00000006542 |
Gene ID - Rat | ENSRNOG00000030017 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MADCAM1 pAb (ATL-HPA077998) | |
Datasheet | Anti MADCAM1 pAb (ATL-HPA077998) Datasheet (External Link) |
Vendor Page | Anti MADCAM1 pAb (ATL-HPA077998) at Atlas Antibodies |
Documents & Links for Anti MADCAM1 pAb (ATL-HPA077998) | |
Datasheet | Anti MADCAM1 pAb (ATL-HPA077998) Datasheet (External Link) |
Vendor Page | Anti MADCAM1 pAb (ATL-HPA077998) |