Description
Product Description
Protein Description: microtubule-actin crosslinking factor 1
Gene Name: MACF1
Alternative Gene Name: ABP620, ACF7, FLJ45612, FLJ46776, KIAA0465, KIAA1251, MACF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107235: 23%, ENSRNOG00000014314: 23%
Entrez Gene ID: 23499
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MACF1
Alternative Gene Name: ABP620, ACF7, FLJ45612, FLJ46776, KIAA0465, KIAA1251, MACF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107235: 23%, ENSRNOG00000014314: 23%
Entrez Gene ID: 23499
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FSGAALEKEQHLGLLHVRAKDYDTRLDCGYFNTLDSSQVPNAVELIAHVDIMRDTSTVSKEECEKVPFSPRTAEFKSRQPADLDSLEKLDPG |
Gene Sequence | FSGAALEKEQHLGLLHVRAKDYDTRLDCGYFNTLDSSQVPNAVELIAHVDIMRDTSTVSKEECEKVPFSPRTAEFKSRQPADLDSLEKLDPG |
Gene ID - Mouse | ENSMUSG00000107235 |
Gene ID - Rat | ENSRNOG00000014314 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MACF1 pAb (ATL-HPA068103) | |
Datasheet | Anti MACF1 pAb (ATL-HPA068103) Datasheet (External Link) |
Vendor Page | Anti MACF1 pAb (ATL-HPA068103) at Atlas Antibodies |
Documents & Links for Anti MACF1 pAb (ATL-HPA068103) | |
Datasheet | Anti MACF1 pAb (ATL-HPA068103) Datasheet (External Link) |
Vendor Page | Anti MACF1 pAb (ATL-HPA068103) |