Anti MAB21L1 pAb (ATL-HPA059864)

Atlas Antibodies

Catalog No: ATL-HPA059864-25

• 

Product Description

Protein Description: mab-21-like 1 (C. elegans)
Gene Name: MAB21L1
Alternative Gene Name: CAGR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057777: 100%, ENSRNOG00000032941: 100%
Entrez Gene ID: 4081
Uniprot ID: Q13394
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVK
• Gene Sequence: SPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVK
• Gene ID - Mouse: ENSMUSG00000057777
• Gene ID - Rat: ENSRNOG00000032941
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.