Description
Product Description
Protein Description: leucine-zipper-like transcription regulator 1
Gene Name: LZTR1
Alternative Gene Name: BTBD29, LZTR-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022761: 100%, ENSRNOG00000001870: 100%
Entrez Gene ID: 8216
Uniprot ID: Q8N653
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LZTR1
Alternative Gene Name: BTBD29, LZTR-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022761: 100%, ENSRNOG00000001870: 100%
Entrez Gene ID: 8216
Uniprot ID: Q8N653
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HSCSDSVEYLTLNFGPFETVHRWRRLPPCDEFVGARRSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDCSWCRAFTTGTP |
Gene Sequence | HSCSDSVEYLTLNFGPFETVHRWRRLPPCDEFVGARRSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDCSWCRAFTTGTP |
Gene ID - Mouse | ENSMUSG00000022761 |
Gene ID - Rat | ENSRNOG00000001870 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti LZTR1 pAb (ATL-HPA071248) | |
Datasheet | Anti LZTR1 pAb (ATL-HPA071248) Datasheet (External Link) |
Vendor Page | Anti LZTR1 pAb (ATL-HPA071248) at Atlas Antibodies |
Documents & Links for Anti LZTR1 pAb (ATL-HPA071248) | |
Datasheet | Anti LZTR1 pAb (ATL-HPA071248) Datasheet (External Link) |
Vendor Page | Anti LZTR1 pAb (ATL-HPA071248) |
Citations
Citations for Anti LZTR1 pAb (ATL-HPA071248) – 1 Found |
Damnernsawad, Alisa; Bottomly, Daniel; Kurtz, Stephen E; Eide, Christopher A; McWeeney, Shannon K; Tyner, Jeffrey W; Nechiporuk, Tamilla. Genome-wide CRISPR screen identifies regulators of MAPK and MTOR pathways mediating sorafenib resistance in acute myeloid leukemia. Haematologica. 2022;107(1):77-85. PubMed |