Anti LZTR1 pAb (ATL-HPA071248)

Atlas Antibodies

Catalog No: ATL-HPA071248-25

• 

Product Description

Protein Description: leucine-zipper-like transcription regulator 1
Gene Name: LZTR1
Alternative Gene Name: BTBD29, LZTR-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022761: 100%, ENSRNOG00000001870: 100%
Entrez Gene ID: 8216
Uniprot ID: Q8N653
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HSCSDSVEYLTLNFGPFETVHRWRRLPPCDEFVGARRSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDCSWCRAFTTGTP
• Gene Sequence: HSCSDSVEYLTLNFGPFETVHRWRRLPPCDEFVGARRSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDCSWCRAFTTGTP
• Gene ID - Mouse: ENSMUSG00000022761
• Gene ID - Rat: ENSRNOG00000001870
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti LZTR1 pAb (ATL-HPA071248) – 1 Found

Damnernsawad, Alisa; Bottomly, Daniel; Kurtz, Stephen E; Eide, Christopher A; McWeeney, Shannon K; Tyner, Jeffrey W; Nechiporuk, Tamilla. Genome-wide CRISPR screen identifies regulators of MAPK and MTOR pathways mediating sorafenib resistance in acute myeloid leukemia. Haematologica. 2022;107(1):77-85.