Protein Description: leucine zipper like transcription regulator 1
Gene Name: LZTR1
Alternative Gene Name: BTBD29, LZTR-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022761: 95%, ENSRNOG00000001870: 95%
Entrez Gene ID: 8216
Uniprot ID: Q8N653
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LZTR1
Alternative Gene Name: BTBD29, LZTR-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022761: 95%, ENSRNOG00000001870: 95%
Entrez Gene ID: 8216
Uniprot ID: Q8N653
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TQPASELPSGRLFHAAAVISDAMYIFGGTVDNNIRSGEMYRFQFSCYPKCTLHEDYGRLWESRQFCDVEFVLGEKEECVQGHVAIVTA |
Documents & Links for Anti LZTR1 pAb (ATL-HPA067852) | |
Datasheet | Anti LZTR1 pAb (ATL-HPA067852) Datasheet (External Link) |
Vendor Page | Anti LZTR1 pAb (ATL-HPA067852) at Atlas |
Documents & Links for Anti LZTR1 pAb (ATL-HPA067852) | |
Datasheet | Anti LZTR1 pAb (ATL-HPA067852) Datasheet (External Link) |
Vendor Page | Anti LZTR1 pAb (ATL-HPA067852) |