Anti LYVE1 pAb (ATL-HPA042953)

Atlas Antibodies

Catalog No: ATL-HPA042953-25

• 
• 

Product Description

Protein Description: lymphatic vessel endothelial hyaluronan receptor 1
Gene Name: LYVE1
Alternative Gene Name: LYVE-1, XLKD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030787: 63%, ENSRNOG00000026902: 61%
Entrez Gene ID: 10894
Uniprot ID: Q9Y5Y7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAA
• Gene Sequence: FETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAA
• Gene ID - Mouse: ENSMUSG00000030787
• Gene ID - Rat: ENSRNOG00000026902
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti LYVE1 pAb (ATL-HPA042953) – 2 Found

Bizou, Mathilde; Itier, Romain; Majdoubi, Mina; Abbadi, Dounia; Pichery, Estelle; Dutaur, Marianne; Marsal, Dimitri; Calise, Denis; Garmy-Susini, Barbara; Douin-Echinard, Victorine; Roncalli, Jérome; Parini, Angelo; Pizzinat, Nathalie. Cardiac macrophage subsets differentially regulate lymphatic network remodeling during pressure overload. Scientific Reports. 2021;11(1):16801. 

Wang, Meng; Li, Yue; Xiao, Yunyun; Yang, Muwen; Chen, Jinxin; Jian, Yunting; Chen, Xin; Shi, Dongni; Chen, Xiangfu; Ouyang, Ying; Kong, Lingzhi; Huang, Xinjian; Bai, Jiewen; Lin, Chuyong; Song, Libing. Nicotine-mediated OTUD3 downregulation inhibits VEGF-C mRNA decay to promote lymphatic metastasis of human esophageal cancer. Nature Communications. 2021;12(1):7006.