Protein Description: LysM, putative peptidoglycan-binding, domain containing 1
Gene Name: LYSMD1
Alternative Gene Name: MGC35223, RP11-68I18.5, SB145
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094935: 64%, ENSRNOG00000021099: 58%
Entrez Gene ID: 388695
Uniprot ID: Q96S90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LYSMD1
Alternative Gene Name: MGC35223, RP11-68I18.5, SB145
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094935: 64%, ENSRNOG00000021099: 58%
Entrez Gene ID: 388695
Uniprot ID: Q96S90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PILTEPRDLFNGLDSEEEKDGEEKVHPSNSEVWPHSTERKKQETGAGRANGEVLPTPGQET |
Documents & Links for Anti LYSMD1 pAb (ATL-HPA064537) | |
Datasheet | Anti LYSMD1 pAb (ATL-HPA064537) Datasheet (External Link) |
Vendor Page | Anti LYSMD1 pAb (ATL-HPA064537) at Atlas |
Documents & Links for Anti LYSMD1 pAb (ATL-HPA064537) | |
Datasheet | Anti LYSMD1 pAb (ATL-HPA064537) Datasheet (External Link) |
Vendor Page | Anti LYSMD1 pAb (ATL-HPA064537) |