Description
Product Description
Protein Description: LY6/PLAUR domain containing 1
Gene Name: LYPD1
Alternative Gene Name: LYPDC1, MGC29643
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026344: 100%, ENSRNOG00000003453: 100%
Entrez Gene ID: 116372
Uniprot ID: Q8N2G4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LYPD1
Alternative Gene Name: LYPDC1, MGC29643
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026344: 100%, ENSRNOG00000003453: 100%
Entrez Gene ID: 116372
Uniprot ID: Q8N2G4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASA |
| Gene Sequence | GIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASA |
| Gene ID - Mouse | ENSMUSG00000026344 |
| Gene ID - Rat | ENSRNOG00000003453 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti LYPD1 pAb (ATL-HPA068333) | |
| Datasheet | Anti LYPD1 pAb (ATL-HPA068333) Datasheet (External Link) |
| Vendor Page | Anti LYPD1 pAb (ATL-HPA068333) at Atlas Antibodies |
| Documents & Links for Anti LYPD1 pAb (ATL-HPA068333) | |
| Datasheet | Anti LYPD1 pAb (ATL-HPA068333) Datasheet (External Link) |
| Vendor Page | Anti LYPD1 pAb (ATL-HPA068333) |