Protein Description: LY6/PLAUR domain containing 1
Gene Name: LYPD1
Alternative Gene Name: LYPDC1, MGC29643
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026344: 100%, ENSRNOG00000003453: 100%
Entrez Gene ID: 116372
Uniprot ID: Q8N2G4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LYPD1
Alternative Gene Name: LYPDC1, MGC29643
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026344: 100%, ENSRNOG00000003453: 100%
Entrez Gene ID: 116372
Uniprot ID: Q8N2G4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASA |
Documents & Links for Anti LYPD1 pAb (ATL-HPA068333) | |
Datasheet | Anti LYPD1 pAb (ATL-HPA068333) Datasheet (External Link) |
Vendor Page | Anti LYPD1 pAb (ATL-HPA068333) at Atlas |
Documents & Links for Anti LYPD1 pAb (ATL-HPA068333) | |
Datasheet | Anti LYPD1 pAb (ATL-HPA068333) Datasheet (External Link) |
Vendor Page | Anti LYPD1 pAb (ATL-HPA068333) |