Protein Description: lymphocyte antigen 6 family member H
Gene Name: LY6H
Alternative Gene Name: NMLY6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022577: 95%, ENSRNOG00000007334: 95%
Entrez Gene ID: 4062
Uniprot ID: O94772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LY6H
Alternative Gene Name: NMLY6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022577: 95%, ENSRNOG00000007334: 95%
Entrez Gene ID: 4062
Uniprot ID: O94772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASS |
| Documents & Links for Anti LY6H pAb (ATL-HPA077218) | |
| Datasheet | Anti LY6H pAb (ATL-HPA077218) Datasheet (External Link) |
| Vendor Page | Anti LY6H pAb (ATL-HPA077218) at Atlas |
| Documents & Links for Anti LY6H pAb (ATL-HPA077218) | |
| Datasheet | Anti LY6H pAb (ATL-HPA077218) Datasheet (External Link) |
| Vendor Page | Anti LY6H pAb (ATL-HPA077218) |