Protein Description: leucine zipper protein 6
Gene Name: LUZP6
Alternative Gene Name: MPD6, MTPNUT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059206: 30%, ENSRNOG00000003131: 28%
Entrez Gene ID: 767558
Uniprot ID: Q538Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LUZP6
Alternative Gene Name: MPD6, MTPNUT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059206: 30%, ENSRNOG00000003131: 28%
Entrez Gene ID: 767558
Uniprot ID: Q538Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VISYALYQVQTGSLPVYSSVLTKSPLQLQTVIYRLIVQIQHLNIPSSSSTHSS |
Documents & Links for Anti LUZP6 pAb (ATL-HPA077907) | |
Datasheet | Anti LUZP6 pAb (ATL-HPA077907) Datasheet (External Link) |
Vendor Page | Anti LUZP6 pAb (ATL-HPA077907) at Atlas |
Documents & Links for Anti LUZP6 pAb (ATL-HPA077907) | |
Datasheet | Anti LUZP6 pAb (ATL-HPA077907) Datasheet (External Link) |
Vendor Page | Anti LUZP6 pAb (ATL-HPA077907) |