Anti LUZP6 pAb (ATL-HPA077907)

Catalog No:
ATL-HPA077907-25
$303.00
Protein Description: leucine zipper protein 6
Gene Name: LUZP6
Alternative Gene Name: MPD6, MTPNUT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059206: 30%, ENSRNOG00000003131: 28%
Entrez Gene ID: 767558
Uniprot ID: Q538Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence VISYALYQVQTGSLPVYSSVLTKSPLQLQTVIYRLIVQIQHLNIPSSSSTHSS
Gene ID - Mouse ENSMUSG00000059206
Gene ID - Rat ENSMUSG00000059206
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti LUZP6 pAb (ATL-HPA077907)
Datasheet Anti LUZP6 pAb (ATL-HPA077907) Datasheet (External Link)
Vendor Page Anti LUZP6 pAb (ATL-HPA077907) at Atlas

Documents & Links for Anti LUZP6 pAb (ATL-HPA077907)
Datasheet Anti LUZP6 pAb (ATL-HPA077907) Datasheet (External Link)
Vendor Page Anti LUZP6 pAb (ATL-HPA077907)