Protein Description: leukotriene B4 receptor 2
Gene Name: LTB4R2
Alternative Gene Name: BLT2, BLTR2, JULF2, NOP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040432: 74%, ENSRNOG00000020382: 80%
Entrez Gene ID: 56413
Uniprot ID: Q9NPC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LTB4R2
Alternative Gene Name: BLT2, BLTR2, JULF2, NOP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040432: 74%, ENSRNOG00000020382: 80%
Entrez Gene ID: 56413
Uniprot ID: Q9NPC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL |
| Documents & Links for Anti LTB4R2 pAb (ATL-HPA072921) | |
| Datasheet | Anti LTB4R2 pAb (ATL-HPA072921) Datasheet (External Link) |
| Vendor Page | Anti LTB4R2 pAb (ATL-HPA072921) at Atlas |
| Documents & Links for Anti LTB4R2 pAb (ATL-HPA072921) | |
| Datasheet | Anti LTB4R2 pAb (ATL-HPA072921) Datasheet (External Link) |
| Vendor Page | Anti LTB4R2 pAb (ATL-HPA072921) |