Anti LTB4R2 pAb (ATL-HPA072921)

Catalog No:
ATL-HPA072921-25
$303.00

Description

Product Description

Protein Description: leukotriene B4 receptor 2
Gene Name: LTB4R2
Alternative Gene Name: BLT2, BLTR2, JULF2, NOP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040432: 74%, ENSRNOG00000020382: 80%
Entrez Gene ID: 56413
Uniprot ID: Q9NPC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
Gene Sequence SREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
Gene ID - Mouse ENSMUSG00000040432
Gene ID - Rat ENSRNOG00000020382
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti LTB4R2 pAb (ATL-HPA072921)
Datasheet Anti LTB4R2 pAb (ATL-HPA072921) Datasheet (External Link)
Vendor Page Anti LTB4R2 pAb (ATL-HPA072921) at Atlas Antibodies

Documents & Links for Anti LTB4R2 pAb (ATL-HPA072921)
Datasheet Anti LTB4R2 pAb (ATL-HPA072921) Datasheet (External Link)
Vendor Page Anti LTB4R2 pAb (ATL-HPA072921)

Product Description

Protein Description: leukotriene B4 receptor 2
Gene Name: LTB4R2
Alternative Gene Name: BLT2, BLTR2, JULF2, NOP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040432: 74%, ENSRNOG00000020382: 80%
Entrez Gene ID: 56413
Uniprot ID: Q9NPC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
Gene Sequence SREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
Gene ID - Mouse ENSMUSG00000040432
Gene ID - Rat ENSRNOG00000020382
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti LTB4R2 pAb (ATL-HPA072921)
Datasheet Anti LTB4R2 pAb (ATL-HPA072921) Datasheet (External Link)
Vendor Page Anti LTB4R2 pAb (ATL-HPA072921) at Atlas Antibodies

Documents & Links for Anti LTB4R2 pAb (ATL-HPA072921)
Datasheet Anti LTB4R2 pAb (ATL-HPA072921) Datasheet (External Link)
Vendor Page Anti LTB4R2 pAb (ATL-HPA072921)