Anti LSR pAb (ATL-HPA075309)

Atlas Antibodies

Catalog No: ATL-HPA075309-25

• 
• 

Product Description

Protein Description: lipolysis stimulated lipoprotein receptor
Gene Name: LSR
Alternative Gene Name: ILDR3, LISCH7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001247: 76%, ENSRNOG00000021053: 78%
Entrez Gene ID: 51599
Uniprot ID: Q86X29
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYNGYPGGYPGDVDRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSM
• Gene Sequence: GVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYNGYPGGYPGDVDRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSM
• Gene ID - Mouse: ENSMUSG00000001247
• Gene ID - Rat: ENSRNOG00000021053
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.