Protein Description: LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Gene Name: LSM2
Alternative Gene Name: C6orf28, G7b, YBL026W
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007050: 100%, ENSRNOG00000048725: 100%
Entrez Gene ID: 57819
Uniprot ID: Q9Y333
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LSM2
Alternative Gene Name: C6orf28, G7b, YBL026W
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007050: 100%, ENSRNOG00000048725: 100%
Entrez Gene ID: 57819
Uniprot ID: Q9Y333
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ |
Documents & Links for Anti LSM2 pAb (ATL-HPA066718) | |
Datasheet | Anti LSM2 pAb (ATL-HPA066718) Datasheet (External Link) |
Vendor Page | Anti LSM2 pAb (ATL-HPA066718) at Atlas |
Documents & Links for Anti LSM2 pAb (ATL-HPA066718) | |
Datasheet | Anti LSM2 pAb (ATL-HPA066718) Datasheet (External Link) |
Vendor Page | Anti LSM2 pAb (ATL-HPA066718) |