Anti LSM14B pAb (ATL-HPA061189)

Catalog No:
ATL-HPA061189-25
$303.00

Description

Product Description

Protein Description: LSM family member 14B
Gene Name: LSM14B
Alternative Gene Name: bA11M20.3, C20orf40, FAM61B, FLJ25473, FT005, LSM13, RAP55B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039108: 93%, ENSRNOG00000054557: 61%
Entrez Gene ID: 149986
Uniprot ID: Q9BX40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLGSASASPFQPHVPYSPFRGMAPYGPLAASSLLSQQYAASLGLGAGFPSIPVGKSPMVEQAVQTGSADNLNAK
Gene Sequence SLGSASASPFQPHVPYSPFRGMAPYGPLAASSLLSQQYAASLGLGAGFPSIPVGKSPMVEQAVQTGSADNLNAK
Gene ID - Mouse ENSMUSG00000039108
Gene ID - Rat ENSRNOG00000054557
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti LSM14B pAb (ATL-HPA061189)
Datasheet Anti LSM14B pAb (ATL-HPA061189) Datasheet (External Link)
Vendor Page Anti LSM14B pAb (ATL-HPA061189) at Atlas Antibodies

Documents & Links for Anti LSM14B pAb (ATL-HPA061189)
Datasheet Anti LSM14B pAb (ATL-HPA061189) Datasheet (External Link)
Vendor Page Anti LSM14B pAb (ATL-HPA061189)

Citations

Citations for Anti LSM14B pAb (ATL-HPA061189) – 1 Found
Di Stefano, Bruno; Luo, En-Ching; Haggerty, Chuck; Aigner, Stefan; Charlton, Jocelyn; Brumbaugh, Justin; Ji, Fei; Rabano Jiménez, Inés; Clowers, Katie J; Huebner, Aaron J; Clement, Kendell; Lipchina, Inna; de Kort, Marit A C; Anselmo, Anthony; Pulice, John; Gerli, Mattia F M; Gu, Hongcang; Gygi, Steven P; Sadreyev, Ruslan I; Meissner, Alexander; Yeo, Gene W; Hochedlinger, Konrad. The RNA Helicase DDX6 Controls Cellular Plasticity by Modulating P-Body Homeostasis. Cell Stem Cell. 2019;25(5):622-638.e13.  PubMed

Product Description

Protein Description: LSM family member 14B
Gene Name: LSM14B
Alternative Gene Name: bA11M20.3, C20orf40, FAM61B, FLJ25473, FT005, LSM13, RAP55B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039108: 93%, ENSRNOG00000054557: 61%
Entrez Gene ID: 149986
Uniprot ID: Q9BX40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLGSASASPFQPHVPYSPFRGMAPYGPLAASSLLSQQYAASLGLGAGFPSIPVGKSPMVEQAVQTGSADNLNAK
Gene Sequence SLGSASASPFQPHVPYSPFRGMAPYGPLAASSLLSQQYAASLGLGAGFPSIPVGKSPMVEQAVQTGSADNLNAK
Gene ID - Mouse ENSMUSG00000039108
Gene ID - Rat ENSRNOG00000054557
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti LSM14B pAb (ATL-HPA061189)
Datasheet Anti LSM14B pAb (ATL-HPA061189) Datasheet (External Link)
Vendor Page Anti LSM14B pAb (ATL-HPA061189) at Atlas Antibodies

Documents & Links for Anti LSM14B pAb (ATL-HPA061189)
Datasheet Anti LSM14B pAb (ATL-HPA061189) Datasheet (External Link)
Vendor Page Anti LSM14B pAb (ATL-HPA061189)

Citations

Citations for Anti LSM14B pAb (ATL-HPA061189) – 1 Found
Di Stefano, Bruno; Luo, En-Ching; Haggerty, Chuck; Aigner, Stefan; Charlton, Jocelyn; Brumbaugh, Justin; Ji, Fei; Rabano Jiménez, Inés; Clowers, Katie J; Huebner, Aaron J; Clement, Kendell; Lipchina, Inna; de Kort, Marit A C; Anselmo, Anthony; Pulice, John; Gerli, Mattia F M; Gu, Hongcang; Gygi, Steven P; Sadreyev, Ruslan I; Meissner, Alexander; Yeo, Gene W; Hochedlinger, Konrad. The RNA Helicase DDX6 Controls Cellular Plasticity by Modulating P-Body Homeostasis. Cell Stem Cell. 2019;25(5):622-638.e13.  PubMed