Protein Description: leucine rich repeat transmembrane neuronal 3
Gene Name: LRRTM3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042846: 97%, ENSRNOG00000026466: 96%
Entrez Gene ID: 347731
Uniprot ID: Q86VH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRRTM3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042846: 97%, ENSRNOG00000026466: 96%
Entrez Gene ID: 347731
Uniprot ID: Q86VH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | STQEFYVDYKPTNTETSEMLLNGTGPCTYNKSGSRECEIPLSMNVSTFLAYDQPTISYCGVHHELLSHKSFETNAQEDTMETHLETELDL |
| Documents & Links for Anti LRRTM3 pAb (ATL-HPA078598) | |
| Datasheet | Anti LRRTM3 pAb (ATL-HPA078598) Datasheet (External Link) |
| Vendor Page | Anti LRRTM3 pAb (ATL-HPA078598) at Atlas |
| Documents & Links for Anti LRRTM3 pAb (ATL-HPA078598) | |
| Datasheet | Anti LRRTM3 pAb (ATL-HPA078598) Datasheet (External Link) |
| Vendor Page | Anti LRRTM3 pAb (ATL-HPA078598) |