Anti LRRTM1 pAb (ATL-HPA062660)

Atlas Antibodies

Catalog No: ATL-HPA062660-25

• 

Product Description

Protein Description: leucine rich repeat transmembrane neuronal 1
Gene Name: LRRTM1
Alternative Gene Name: FLJ32082
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060780: 97%, ENSRNOG00000006093: 97%
Entrez Gene ID: 347730
Uniprot ID: Q86UE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HFPRLISLHSLCLRRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPHLQSLQLD
• Gene Sequence: HFPRLISLHSLCLRRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPHLQSLQLD
• Gene ID - Mouse: ENSMUSG00000060780
• Gene ID - Rat: ENSRNOG00000006093
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.