Protein Description: leucine rich repeat neuronal 4
Gene Name: LRRN4
Alternative Gene Name: C20orf75, dJ1056H1.1, NLRR4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043110: 49%, ENSRNOG00000032989: 49%
Entrez Gene ID: 164312
Uniprot ID: Q8WUT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRRN4
Alternative Gene Name: C20orf75, dJ1056H1.1, NLRR4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043110: 49%, ENSRNOG00000032989: 49%
Entrez Gene ID: 164312
Uniprot ID: Q8WUT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SNSSVFPRAASTTRTQHRGEHAPELVLEPDISAASTPLASKLLGPFPTSWDRSISSPQPGQRTHATPQAPNPSLSEGEIPVLLLDDY |
Documents & Links for Anti LRRN4 pAb (ATL-HPA075974) | |
Datasheet | Anti LRRN4 pAb (ATL-HPA075974) Datasheet (External Link) |
Vendor Page | Anti LRRN4 pAb (ATL-HPA075974) at Atlas |
Documents & Links for Anti LRRN4 pAb (ATL-HPA075974) | |
Datasheet | Anti LRRN4 pAb (ATL-HPA075974) Datasheet (External Link) |
Vendor Page | Anti LRRN4 pAb (ATL-HPA075974) |