Anti LRRN4 pAb (ATL-HPA075974)

Atlas Antibodies

Catalog No: ATL-HPA075974-25

• 

Product Description

Protein Description: leucine rich repeat neuronal 4
Gene Name: LRRN4
Alternative Gene Name: C20orf75, dJ1056H1.1, NLRR4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043110: 49%, ENSRNOG00000032989: 49%
Entrez Gene ID: 164312
Uniprot ID: Q8WUT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SNSSVFPRAASTTRTQHRGEHAPELVLEPDISAASTPLASKLLGPFPTSWDRSISSPQPGQRTHATPQAPNPSLSEGEIPVLLLDDY
• Gene Sequence: SNSSVFPRAASTTRTQHRGEHAPELVLEPDISAASTPLASKLLGPFPTSWDRSISSPQPGQRTHATPQAPNPSLSEGEIPVLLLDDY
• Gene ID - Mouse: ENSMUSG00000043110
• Gene ID - Rat: ENSRNOG00000032989
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.