Protein Description: leucine rich repeats and death domain containing 1
Gene Name: LRRD1
Alternative Gene Name: IMAGE:4798971
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040367: 70%, ENSRNOG00000026196: 75%
Entrez Gene ID: 401387
Uniprot ID: A4D1F6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRRD1
Alternative Gene Name: IMAGE:4798971
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040367: 70%, ENSRNOG00000026196: 75%
Entrez Gene ID: 401387
Uniprot ID: A4D1F6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NLTALPSAIYNIFSLKEINFDDNPLLRPPVEICKGKQLYTIARYLQRADERDGRLK |
Documents & Links for Anti LRRD1 pAb (ATL-HPA079440 w/enhanced validation) | |
Datasheet | Anti LRRD1 pAb (ATL-HPA079440 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LRRD1 pAb (ATL-HPA079440 w/enhanced validation) at Atlas |
Documents & Links for Anti LRRD1 pAb (ATL-HPA079440 w/enhanced validation) | |
Datasheet | Anti LRRD1 pAb (ATL-HPA079440 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LRRD1 pAb (ATL-HPA079440 w/enhanced validation) |