Anti LRRC9 pAb (ATL-HPA077675)

Catalog No:
ATL-HPA077675-25
$447.00
Protein Description: leucine rich repeat containing 9
Gene Name: LRRC9
Alternative Gene Name: FLJ46156
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021090: 67%, ENSRNOG00000005409: 67%
Entrez Gene ID: 341883
Uniprot ID: Q6ZRR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence KHLLQILEKGFKDSETSKLPLKKEAIIVSNSLSISECPRIEFLQQKHKDEKKISLKHELFRHGILLITKVFLGQSVQAHEKESISQSNYPMVNSVFIPRKY
Gene ID - Mouse ENSMUSG00000021090
Gene ID - Rat ENSMUSG00000021090
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti LRRC9 pAb (ATL-HPA077675)
Datasheet Anti LRRC9 pAb (ATL-HPA077675) Datasheet (External Link)
Vendor Page Anti LRRC9 pAb (ATL-HPA077675) at Atlas

Documents & Links for Anti LRRC9 pAb (ATL-HPA077675)
Datasheet Anti LRRC9 pAb (ATL-HPA077675) Datasheet (External Link)
Vendor Page Anti LRRC9 pAb (ATL-HPA077675)