Protein Description: leucine rich repeat containing 9
Gene Name: LRRC9
Alternative Gene Name: FLJ46156
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021090: 67%, ENSRNOG00000005409: 67%
Entrez Gene ID: 341883
Uniprot ID: Q6ZRR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRRC9
Alternative Gene Name: FLJ46156
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021090: 67%, ENSRNOG00000005409: 67%
Entrez Gene ID: 341883
Uniprot ID: Q6ZRR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KHLLQILEKGFKDSETSKLPLKKEAIIVSNSLSISECPRIEFLQQKHKDEKKISLKHELFRHGILLITKVFLGQSVQAHEKESISQSNYPMVNSVFIPRKY |
Gene ID - Mouse | ENSMUSG00000021090 |
Gene ID - Rat | ENSMUSG00000021090 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LRRC9 pAb (ATL-HPA077675) | |
Datasheet | Anti LRRC9 pAb (ATL-HPA077675) Datasheet (External Link) |
Vendor Page | Anti LRRC9 pAb (ATL-HPA077675) at Atlas |
Documents & Links for Anti LRRC9 pAb (ATL-HPA077675) | |
Datasheet | Anti LRRC9 pAb (ATL-HPA077675) Datasheet (External Link) |
Vendor Page | Anti LRRC9 pAb (ATL-HPA077675) |