Protein Description: leucine rich repeat containing 72
Gene Name: LRRC72
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020545: 62%, ENSRNOG00000025049: 64%
Entrez Gene ID: 100506049
Uniprot ID: A6NJI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRRC72
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020545: 62%, ENSRNOG00000025049: 64%
Entrez Gene ID: 100506049
Uniprot ID: A6NJI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SIAFGGKVDASWDPKSPFKQKPAQRVPSDFAFANNVDKTVLDDPEDAVFVRSMKRSVMTLTSMNWDTVPTREERYLEEEGTETAQMLTVT |
Documents & Links for Anti LRRC72 pAb (ATL-HPA020554) | |
Datasheet | Anti LRRC72 pAb (ATL-HPA020554) Datasheet (External Link) |
Vendor Page | Anti LRRC72 pAb (ATL-HPA020554) at Atlas |
Documents & Links for Anti LRRC72 pAb (ATL-HPA020554) | |
Datasheet | Anti LRRC72 pAb (ATL-HPA020554) Datasheet (External Link) |
Vendor Page | Anti LRRC72 pAb (ATL-HPA020554) |