Protein Description: leucine rich repeat containing 4C
Gene Name: LRRC4C
Alternative Gene Name: KIAA1580, NGL-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050587: 100%, ENSRNOG00000029798: 100%
Entrez Gene ID: 57689
Uniprot ID: Q9HCJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRRC4C
Alternative Gene Name: KIAA1580, NGL-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050587: 100%, ENSRNOG00000029798: 100%
Entrez Gene ID: 57689
Uniprot ID: Q9HCJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKD |
| Documents & Links for Anti LRRC4C pAb (ATL-HPA075816) | |
| Datasheet | Anti LRRC4C pAb (ATL-HPA075816) Datasheet (External Link) |
| Vendor Page | Anti LRRC4C pAb (ATL-HPA075816) at Atlas |
| Documents & Links for Anti LRRC4C pAb (ATL-HPA075816) | |
| Datasheet | Anti LRRC4C pAb (ATL-HPA075816) Datasheet (External Link) |
| Vendor Page | Anti LRRC4C pAb (ATL-HPA075816) |