Anti LRRC4B pAb (ATL-HPA058986)

Catalog No:
ATL-HPA058986-25
$447.00

Description

Product Description

Protein Description: leucine rich repeat containing 4B
Gene Name: LRRC4B
Alternative Gene Name: DKFZp761A179, HSM, LRIG4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047085: 94%, ENSRNOG00000019418: 94%
Entrez Gene ID: 94030
Uniprot ID: Q9NT99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTAPAPRSSRPTEKAFTVPITDVTENALKDLDD
Gene Sequence GTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTAPAPRSSRPTEKAFTVPITDVTENALKDLDD
Gene ID - Mouse ENSMUSG00000047085
Gene ID - Rat ENSRNOG00000019418
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti LRRC4B pAb (ATL-HPA058986)
Datasheet Anti LRRC4B pAb (ATL-HPA058986) Datasheet (External Link)
Vendor Page Anti LRRC4B pAb (ATL-HPA058986) at Atlas Antibodies

Documents & Links for Anti LRRC4B pAb (ATL-HPA058986)
Datasheet Anti LRRC4B pAb (ATL-HPA058986) Datasheet (External Link)
Vendor Page Anti LRRC4B pAb (ATL-HPA058986)

Product Description

Protein Description: leucine rich repeat containing 4B
Gene Name: LRRC4B
Alternative Gene Name: DKFZp761A179, HSM, LRIG4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047085: 94%, ENSRNOG00000019418: 94%
Entrez Gene ID: 94030
Uniprot ID: Q9NT99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTAPAPRSSRPTEKAFTVPITDVTENALKDLDD
Gene Sequence GTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTAPAPRSSRPTEKAFTVPITDVTENALKDLDD
Gene ID - Mouse ENSMUSG00000047085
Gene ID - Rat ENSRNOG00000019418
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti LRRC4B pAb (ATL-HPA058986)
Datasheet Anti LRRC4B pAb (ATL-HPA058986) Datasheet (External Link)
Vendor Page Anti LRRC4B pAb (ATL-HPA058986) at Atlas Antibodies

Documents & Links for Anti LRRC4B pAb (ATL-HPA058986)
Datasheet Anti LRRC4B pAb (ATL-HPA058986) Datasheet (External Link)
Vendor Page Anti LRRC4B pAb (ATL-HPA058986)