Description
Product Description
Protein Description: leucine rich repeat containing 4B
Gene Name: LRRC4B
Alternative Gene Name: DKFZp761A179, HSM, LRIG4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047085: 94%, ENSRNOG00000019418: 94%
Entrez Gene ID: 94030
Uniprot ID: Q9NT99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRRC4B
Alternative Gene Name: DKFZp761A179, HSM, LRIG4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047085: 94%, ENSRNOG00000019418: 94%
Entrez Gene ID: 94030
Uniprot ID: Q9NT99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTAPAPRSSRPTEKAFTVPITDVTENALKDLDD |
Gene Sequence | GTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTAPAPRSSRPTEKAFTVPITDVTENALKDLDD |
Gene ID - Mouse | ENSMUSG00000047085 |
Gene ID - Rat | ENSRNOG00000019418 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti LRRC4B pAb (ATL-HPA058986) | |
Datasheet | Anti LRRC4B pAb (ATL-HPA058986) Datasheet (External Link) |
Vendor Page | Anti LRRC4B pAb (ATL-HPA058986) at Atlas Antibodies |
Documents & Links for Anti LRRC4B pAb (ATL-HPA058986) | |
Datasheet | Anti LRRC4B pAb (ATL-HPA058986) Datasheet (External Link) |
Vendor Page | Anti LRRC4B pAb (ATL-HPA058986) |