Anti LRRC46 pAb (ATL-HPA074893 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA074893-25

• 

Product Description

Protein Description: leucine rich repeat containing 46
Gene Name: LRRC46
Alternative Gene Name: MGC16309
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020878: 77%, ENSRNOG00000009902: 79%
Entrez Gene ID: 90506
Uniprot ID: Q96FV0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDLSENLIETLKLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLDGQPVVERWISDEEDEASSDEEFPELSGPFCSERGFLKELEQE
• Gene Sequence: LDLSENLIETLKLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLDGQPVVERWISDEEDEASSDEEFPELSGPFCSERGFLKELEQE
• Gene ID - Mouse: ENSMUSG00000020878
• Gene ID - Rat: ENSRNOG00000009902
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.