Protein Description: leucine rich repeat containing 3C
Gene Name: LRRC3C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000086545: 79%, ENSRNOG00000031298: 79%
Entrez Gene ID: 100505591
Uniprot ID: A6NJW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRRC3C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000086545: 79%, ENSRNOG00000031298: 79%
Entrez Gene ID: 100505591
Uniprot ID: A6NJW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV |
| Documents & Links for Anti LRRC3C pAb (ATL-HPA071271) | |
| Datasheet | Anti LRRC3C pAb (ATL-HPA071271) Datasheet (External Link) |
| Vendor Page | Anti LRRC3C pAb (ATL-HPA071271) at Atlas |
| Documents & Links for Anti LRRC3C pAb (ATL-HPA071271) | |
| Datasheet | Anti LRRC3C pAb (ATL-HPA071271) Datasheet (External Link) |
| Vendor Page | Anti LRRC3C pAb (ATL-HPA071271) |