Anti LRRC3C pAb (ATL-HPA071271)

Atlas Antibodies

Catalog No: ATL-HPA071271-25

• 

Product Description

Protein Description: leucine rich repeat containing 3C
Gene Name: LRRC3C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000086545: 79%, ENSRNOG00000031298: 79%
Entrez Gene ID: 100505591
Uniprot ID: A6NJW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV
• Gene Sequence: YVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV
• Gene ID - Mouse: ENSMUSG00000086545
• Gene ID - Rat: ENSRNOG00000031298
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.