Description
Product Description
Protein Description: leucine rich repeat containing 3C
Gene Name: LRRC3C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000086545: 79%, ENSRNOG00000031298: 79%
Entrez Gene ID: 100505591
Uniprot ID: A6NJW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRRC3C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000086545: 79%, ENSRNOG00000031298: 79%
Entrez Gene ID: 100505591
Uniprot ID: A6NJW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV |
Gene Sequence | YVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV |
Gene ID - Mouse | ENSMUSG00000086545 |
Gene ID - Rat | ENSRNOG00000031298 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti LRRC3C pAb (ATL-HPA071271) | |
Datasheet | Anti LRRC3C pAb (ATL-HPA071271) Datasheet (External Link) |
Vendor Page | Anti LRRC3C pAb (ATL-HPA071271) at Atlas Antibodies |
Documents & Links for Anti LRRC3C pAb (ATL-HPA071271) | |
Datasheet | Anti LRRC3C pAb (ATL-HPA071271) Datasheet (External Link) |
Vendor Page | Anti LRRC3C pAb (ATL-HPA071271) |