Protein Description: leucine rich repeat containing 39
Gene Name: LRRC39
Alternative Gene Name: MGC14816
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027961: 92%, ENSRNOG00000015117: 94%
Entrez Gene ID: 127495
Uniprot ID: Q96DD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRRC39
Alternative Gene Name: MGC14816
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027961: 92%, ENSRNOG00000015117: 94%
Entrez Gene ID: 127495
Uniprot ID: Q96DD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PEFIGRFQNLIVLDLSRNTISEIPPGIGLLTRLQELILSYNKIKTVPKELSNCASLEKLELAVNRDICDLPQELSNLL |
Documents & Links for Anti LRRC39 pAb (ATL-HPA077159 w/enhanced validation) | |
Datasheet | Anti LRRC39 pAb (ATL-HPA077159 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LRRC39 pAb (ATL-HPA077159 w/enhanced validation) at Atlas |
Documents & Links for Anti LRRC39 pAb (ATL-HPA077159 w/enhanced validation) | |
Datasheet | Anti LRRC39 pAb (ATL-HPA077159 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LRRC39 pAb (ATL-HPA077159 w/enhanced validation) |