Protein Description: leucine rich repeat containing 28
Gene Name: LRRC28
Alternative Gene Name: FLJ34269, FLJ45242, MGC24976
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030556: 97%, ENSRNOG00000023274: 99%
Entrez Gene ID: 123355
Uniprot ID: Q86X40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRRC28
Alternative Gene Name: FLJ34269, FLJ45242, MGC24976
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030556: 97%, ENSRNOG00000023274: 99%
Entrez Gene ID: 123355
Uniprot ID: Q86X40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KRNSLTSLPENLAQKLPNLVELYLHSNNIVVVPEAIGSLVKLQCLDLSDNALEIVCPEIGRLRALRHLRLANNQLQF |
| Documents & Links for Anti LRRC28 pAb (ATL-HPA066130) | |
| Datasheet | Anti LRRC28 pAb (ATL-HPA066130) Datasheet (External Link) |
| Vendor Page | Anti LRRC28 pAb (ATL-HPA066130) at Atlas |
| Documents & Links for Anti LRRC28 pAb (ATL-HPA066130) | |
| Datasheet | Anti LRRC28 pAb (ATL-HPA066130) Datasheet (External Link) |
| Vendor Page | Anti LRRC28 pAb (ATL-HPA066130) |