Description
Product Description
Protein Description: leucine rich repeat containing 27
Gene Name: LRRC27
Alternative Gene Name: KIAA1674
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111011: 42%, ENSRNOG00000017538: 38%
Entrez Gene ID: 80313
Uniprot ID: Q9C0I9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRRC27
Alternative Gene Name: KIAA1674
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111011: 42%, ENSRNOG00000017538: 38%
Entrez Gene ID: 80313
Uniprot ID: Q9C0I9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NRKVPLNPPGKMKPSKEKSPQASKEMSALQERNLEEKIKQHVLQMREQRRFHGQAPLEEMRKAAEDLEIATELQDEVLKLKLGL |
Gene Sequence | NRKVPLNPPGKMKPSKEKSPQASKEMSALQERNLEEKIKQHVLQMREQRRFHGQAPLEEMRKAAEDLEIATELQDEVLKLKLGL |
Gene ID - Mouse | ENSMUSG00000111011 |
Gene ID - Rat | ENSRNOG00000017538 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti LRRC27 pAb (ATL-HPA067395 w/enhanced validation) | |
Datasheet | Anti LRRC27 pAb (ATL-HPA067395 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LRRC27 pAb (ATL-HPA067395 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti LRRC27 pAb (ATL-HPA067395 w/enhanced validation) | |
Datasheet | Anti LRRC27 pAb (ATL-HPA067395 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LRRC27 pAb (ATL-HPA067395 w/enhanced validation) |