Anti LRRC2 pAb (ATL-HPA064844)

Catalog No:
ATL-HPA064844-100
$596.00

Description

Product Description

Protein Description: leucine rich repeat containing 2
Gene Name: LRRC2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032495: 92%, ENSRNOG00000030688: 92%
Entrez Gene ID: 79442
Uniprot ID: Q9BYS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSMLNLKKLTLL
Gene Sequence LKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSMLNLKKLTLL
Gene ID - Mouse ENSMUSG00000032495
Gene ID - Rat ENSRNOG00000030688
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti LRRC2 pAb (ATL-HPA064844)
Datasheet Anti LRRC2 pAb (ATL-HPA064844) Datasheet (External Link)
Vendor Page Anti LRRC2 pAb (ATL-HPA064844) at Atlas Antibodies

Documents & Links for Anti LRRC2 pAb (ATL-HPA064844)
Datasheet Anti LRRC2 pAb (ATL-HPA064844) Datasheet (External Link)
Vendor Page Anti LRRC2 pAb (ATL-HPA064844)

Product Description

Protein Description: leucine rich repeat containing 2
Gene Name: LRRC2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032495: 92%, ENSRNOG00000030688: 92%
Entrez Gene ID: 79442
Uniprot ID: Q9BYS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSMLNLKKLTLL
Gene Sequence LKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSMLNLKKLTLL
Gene ID - Mouse ENSMUSG00000032495
Gene ID - Rat ENSRNOG00000030688
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti LRRC2 pAb (ATL-HPA064844)
Datasheet Anti LRRC2 pAb (ATL-HPA064844) Datasheet (External Link)
Vendor Page Anti LRRC2 pAb (ATL-HPA064844) at Atlas Antibodies

Documents & Links for Anti LRRC2 pAb (ATL-HPA064844)
Datasheet Anti LRRC2 pAb (ATL-HPA064844) Datasheet (External Link)
Vendor Page Anti LRRC2 pAb (ATL-HPA064844)