Protein Description: leucine rich repeat containing 17
Gene Name: LRRC17
Alternative Gene Name: H_RG318M05.3, P37NB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039883: 88%, ENSRNOG00000012817: 88%
Entrez Gene ID: 10234
Uniprot ID: Q8N6Y2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRRC17
Alternative Gene Name: H_RG318M05.3, P37NB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039883: 88%, ENSRNOG00000012817: 88%
Entrez Gene ID: 10234
Uniprot ID: Q8N6Y2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DYNIHYLYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDEWEKKHRDHTAKKQSVII |
Documents & Links for Anti LRRC17 pAb (ATL-HPA073458) | |
Datasheet | Anti LRRC17 pAb (ATL-HPA073458) Datasheet (External Link) |
Vendor Page | Anti LRRC17 pAb (ATL-HPA073458) at Atlas |
Documents & Links for Anti LRRC17 pAb (ATL-HPA073458) | |
Datasheet | Anti LRRC17 pAb (ATL-HPA073458) Datasheet (External Link) |
Vendor Page | Anti LRRC17 pAb (ATL-HPA073458) |