Protein Description: leucine rich repeat protein 1
Gene Name: LRR1
Alternative Gene Name: LRR-1, MGC20689, PPIL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034883: 82%, ENSRNOG00000004216: 82%
Entrez Gene ID: 122769
Uniprot ID: Q96L50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRR1
Alternative Gene Name: LRR-1, MGC20689, PPIL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034883: 82%, ENSRNOG00000004216: 82%
Entrez Gene ID: 122769
Uniprot ID: Q96L50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GSHIIPFHLCQDLDTAKICVCGRFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDM |
Documents & Links for Anti LRR1 pAb (ATL-HPA065703) | |
Datasheet | Anti LRR1 pAb (ATL-HPA065703) Datasheet (External Link) |
Vendor Page | Anti LRR1 pAb (ATL-HPA065703) at Atlas |
Documents & Links for Anti LRR1 pAb (ATL-HPA065703) | |
Datasheet | Anti LRR1 pAb (ATL-HPA065703) Datasheet (External Link) |
Vendor Page | Anti LRR1 pAb (ATL-HPA065703) |