Protein Description: low density lipoprotein receptor-related protein 1B
Gene Name: LRP1B
Alternative Gene Name: LRP-DIT, LRPDIT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049252: 95%, ENSRNOG00000039050: 56%
Entrez Gene ID: 53353
Uniprot ID: Q9NZR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRP1B
Alternative Gene Name: LRP-DIT, LRPDIT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049252: 95%, ENSRNOG00000039050: 56%
Entrez Gene ID: 53353
Uniprot ID: Q9NZR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GGPSAFKLPHTAPPIYLNSDLKGPLTAGPTNYSNPVYAKLYMDGQNCRNSLGSVDERKELLPKK |
| Documents & Links for Anti LRP1B pAb (ATL-HPA069094) | |
| Datasheet | Anti LRP1B pAb (ATL-HPA069094) Datasheet (External Link) |
| Vendor Page | Anti LRP1B pAb (ATL-HPA069094) at Atlas |
| Documents & Links for Anti LRP1B pAb (ATL-HPA069094) | |
| Datasheet | Anti LRP1B pAb (ATL-HPA069094) Datasheet (External Link) |
| Vendor Page | Anti LRP1B pAb (ATL-HPA069094) |